| Read Date | 2005-09-23 08:09:00 |
|---|---|
| Read Number | X0000058111367200509230809 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 6_C0282 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Potassium phosphate monobasic | 5.0 | 0.1 M | [K+].[O-]P(=O)(O)O |
| PEG 20000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | PfR64 |
|---|---|
| Spine Status | aggregation screening |
| Length | 65 aa |
| Mass | 7.65 kD |
| ext | 5960 |
| pI | 5.15 |
| Name | Hypothetical UPF0165 protein PF2058 |
| Database References | NCBI UniProt |
| PFAM | PF01954 |
| PDB Structures | 2NWT (Best Match) |
| Gene | |
|---|---|
| Organism | Pyrococcus furiosus |
| Genus | Pyrococcus |
| Species | furiosus |
| Strain | |
| Sequence | MQVIEAIYEDGVLKPLKKLKLKEHSKVIIKIIDEEELEKILDSMVIEKVEGIDYKKLKEAYYESL |