| Read Date | 2007-08-06 09:48:00 |
|---|---|
| Read Number | X0000091061511200708060948 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0762 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Ammonium thiocyanate | 7.5 | 0.1 M | [S-]C#N.[NH4+] |
| PEG 1000 | 7.5 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ShR57 |
|---|---|
| Spine Status | HSQC collected |
| Length | 104 aa |
| Mass | 11.41 kD |
| ext | 5960 |
| pI | 4.58 |
| Name | Assimilatory nitrite reductase |
| Database References | NCBI UniProt |
| PFAM | PF13806 |
| PDB Structures | 3C0D (Best Match) |
| Gene | |
|---|---|
| Organism | Staphylococcus haemolyticus |
| Genus | Staphylococcus |
| Species | haemolyticus |
| Strain | |
| Sequence | MKSMEKVKVTTLEELTPLIGKKVIVDGKEIGIFLTESGDIHAINNICPHKQGPLSEGTVSGDYVYCPLHDQKVDLRSGEVQEPDTGCVETYQVEVIDGDVYVCL |