| Read Date | 2007-08-09 10:40:00 |
|---|---|
| Read Number | X0000091181164200708091040 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1035 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 0.5 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | BcR180 |
|---|---|
| Spine Status | HSQC collected |
| Length | 180 aa |
| Mass | 21.08 kD |
| ext | 8940 |
| pI | 5.63 |
| Name | Probable Sigma (54) modulation protein / SSU ribosomal protein S30P |
| Database References | NCBI UniProt |
| PFAM | PF02482 |
| PDB Structures | 3K2T (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus cereus |
| Genus | Bacillus |
| Species | cereus |
| Strain | |
| Sequence | MKFNIRGENIEVTPALKEYVEKKLSKLERYFDTFPEIKVNLKVYSDKQRVEVTIPFTDLLLRAEETNSDMYAAIDLVVDKIERQIRKHKTKVNRKLREKGSIKTNFILPEAVAVLDEVEEDELELVRTKRFDLKPMDVEEAILQMDMLGHNFFVFTNADTNETNVVYGRKDGKYGLIETK |