| Read Date | 2007-08-20 09:41:00 |
|---|---|
| Read Number | X0000091571377200708200941 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0093 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | CsR93 |
|---|---|
| Spine Status | crystal hits |
| Length | 254 aa |
| Mass | 27.89 kD |
| ext | 13980 |
| pI | 5.62 |
| Name | Transcriptional regulator, DeoR family |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures | 3IXQ (Best Match) |
| Gene | |
|---|---|
| Organism | Colwellia psychrerythraea |
| Genus | Colwellia |
| Species | psychrerythraea |
| Strain | |
| Sequence | MSKRNTQQRRHNIIADLNAQGEVSVDSLAKQFDTSEVTIRKDLAALETSGLLLRRYGGAVALPSEITEAKVDQLSQQKLHIAKKAAMLIRDHNRIIIDSGQTTSALVSELANKKGLVVMTNALSIANEIHALENEPTLLMTGGTWDATSEAFQGQVAEQVLRSYDFDQLFIGADGIDIKRGTTTFNELIGLSRVMAEVAREVIVMVESAKITKKIPNLELNWQQIHTVITDDGLSEEMRIALTEQGVKLIIAKG |