| Read Date | 2007-09-26 10:47:00 |
|---|---|
| Read Number | X0000093141532200709261047 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1535 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
| Tacsimate | 7.0 | 35.0 % (v/v) | missing |
![]() | ShR51 |
|---|---|
| Spine Status | aggregation screening |
| Length | 167 aa |
| Mass | 19.31 kD |
| ext | 18910 |
| pI | 4.63 |
| Name | Probable 16S rRNA processing protein |
| Database References | NCBI UniProt |
| PFAM | PF01782 |
| PDB Structures | 2F1L (Best Match) |
| Gene | |
|---|---|
| Organism | Staphylococcus haemolyticus |
| Genus | Staphylococcus |
| Species | haemolyticus |
| Strain | |
| Sequence | MQVEVGQIVNTHGIKGEVKVKSNSDFTDTRFQPGEVLTVNHQNHEEQLTVLSYRVHKGFHMLKFEGINNINDVEQYKGDYLYQERDHEDIELAENEYYYSDIIGSTVFDNDNQPIGRVINIFETGANDVWVVKGEKEYLIPYIADVVKEIDIENKTIRITPMEGLLD |