| Read Date | 2005-09-30 09:31:00 |
|---|---|
| Read Number | X0000058811223200509300931 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0654 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Potassium nitrate | 6.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
| PEG 4000 | 6.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SR374 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 85 aa |
| Mass | 9.65 kD |
| ext | 19480 |
| pI | 4.46 |
| Name | YmfJ protein |
| Database References | NCBI UniProt |
| PFAM | PF11588 |
| PDB Structures | 3D0W (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MSVLENWDSWKNFLGDRLNYAQDKGMSQDTITDLATEIGSYLANEVESKNEQEKVLADLWSVASKDEQHAIANMMVKLVENNSTH |