 
    | Read Date | 2007-10-11 13:46:00 | 
|---|---|
| Read Number | X0000093390872200710111346 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | clear | 
| Cocktail | 7_C1106 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Lithium chloride | 5.0 | 1.0 M | [Li+].[Cl-] | 
| Citric acid | 5.0 | 0.1 M | C(C(=O)O)C(CC(=O)O)(C(=O)… | 
|  | StR222 | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 161 aa | 
| Mass | 18.23 kD | 
| ext | 2980 | 
| pI | 9.66 | 
| Name | Periplasmic protein related to spheroblast formation | 
| Database References | UniProt | 
| PFAM | PF07813 | 
| PDB Structures | 3OEO (Best Match) | 
| Gene | |
|---|---|
| Organism | Salmonella typhimurium | 
| Genus | Salmonella | 
| Species | typhimurium | 
| Strain | |
| Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |