Read Date | 2007-10-11 15:05:00 |
---|---|
Read Number | X0000093391506200710111505 |
Week | 1 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | crystal |
Cocktail | 7_C1337 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
Lithium sulfate monohydrate | 8.5 | 1.0 M | [Li+].[Li+].[O-]S([O-])(=… |
Nickel(II) chloride hexahydrate | 8.5 | 0.0 M | [Ni+2].[Cl-].[Cl-].O.O.O.… |
![]() | StR222 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 161 aa |
Mass | 18.23 kD |
ext | 2980 |
pI | 9.66 |
Name | Periplasmic protein related to spheroblast formation |
Database References | UniProt |
PFAM | PF07813 |
PDB Structures | 3OEO (Best Match) |
Gene | |
---|---|
Organism | Salmonella typhimurium |
Genus | Salmonella |
Species | typhimurium |
Strain | |
Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |