| Read Date | 2007-10-11 15:05:00 |
|---|---|
| Read Number | X0000093391514200710111505 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C1339 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Ammonium phosphate monobasic | 8.5 | 0.2 M | [O-]P(=O)(O)O.[NH4+] |
| MPD | 8.5 | 50.0 % (v/v) | CC(O)CC(C)(C)O |
![]() | StR222 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 161 aa |
| Mass | 18.23 kD |
| ext | 2980 |
| pI | 9.66 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |