Read Date | 2007-10-11 15:08:00 |
---|---|
Read Number | X0000093391325200710111508 |
Week | 1 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | crystal |
Cocktail | 7_C0560 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
Calcium acetate | 7.0 | 0.1 M | [Ca+2].[O-]C(=O)C.[O-]C(=… |
PEG 4000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | StR222 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 161 aa |
Mass | 18.23 kD |
ext | 2980 |
pI | 9.66 |
Name | Periplasmic protein related to spheroblast formation |
Database References | UniProt |
PFAM | PF07813 |
PDB Structures | 3OEO (Best Match) |
Gene | |
---|---|
Organism | Salmonella typhimurium |
Genus | Salmonella |
Species | typhimurium |
Strain | |
Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |