| Read Date | 2007-10-19 11:57:00 |
|---|---|
| Read Number | X0000093390463200710191157 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0608 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Potassium phosphate dibasic anhydrous | 9.0 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
| PEG 4000 | 9.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | StR222 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 161 aa |
| Mass | 18.23 kD |
| ext | 2980 |
| pI | 9.66 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |