| Read Date | 2007-10-25 12:40:00 |
|---|---|
| Read Number | X0000093390747200710251240 |
| Week | 3 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0715 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Magnesium chloride hexahydrate | 6.0 | 0.1 M | [Mg+2].[Cl-].[Cl-].O.O.O.… |
| PEG 1000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | StR222 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 161 aa |
| Mass | 18.23 kD |
| ext | 2980 |
| pI | 9.66 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MRKLTALFVASTLAMGAANLAHAAETTTAAPADAKPMMQHKGKFGPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERPAQEGKMPAAAE |