| Read Date | 2005-09-30 09:33:00 |
|---|---|
| Read Number | X0000058831172200509300933 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1037 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 7.5 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 7.5 | 0.7 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR411 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 134 aa |
| Mass | 15.19 kD |
| ext | 37930 |
| pI | 4.48 |
| Name | YopX protein |
| Database References | NCBI UniProt |
| PFAM | PF09643 |
| PDB Structures | 2I2L (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISADYDVTAVGWVEYATIEVIGDVYQNPELLEGVK |