Read Date | 2007-10-15 09:47:00 |
---|---|
Read Number | X0000093581512200710150947 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | crystal |
Cocktail | 7_C1530 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Potassium thiocyanate | 7.0 | 0.5 M | C(#N)[S-].[K+] |
Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | HR3159 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 160 aa |
Mass | 17.82 kD |
ext | 15470 |
pI | 4.33 |
Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; |
Database References | NCBI UniProt |
PFAM | PF01248 |
PDB Structures | 2KG4 (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |