 
    | Read Date | 2007-10-15 09:51:00 | 
|---|---|
| Read Number | X0000093581166200710150951 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | other | 
| 10-Way Classifier | precip | 
| Cocktail | 7_C0844 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 | 
| Ammonium nitrate | 7.0 | 0.1 M | [O-][N+]([O-])=O.[NH4+] | 
| PEG 400 | 7.0 | 40.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | HR3159 | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 160 aa | 
| Mass | 17.82 kD | 
| ext | 15470 | 
| pI | 4.33 | 
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; | 
| Database References | NCBI UniProt | 
| PFAM | PF01248 | 
| PDB Structures | 2KG4 (Best Match) | 
| Gene | |
|---|---|
| Organism | Homo sapiens | 
| Genus | Homo | 
| Species | sapiens | 
| Strain | |
| Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |