Read Date | 2007-10-15 09:59:00 |
---|---|
Read Number | X0000093580590200710150959 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | crystal |
Cocktail | 7_C0808 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
Potassium nitrate | 4.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
PEG 1000 | 4.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | HR3159 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 160 aa |
Mass | 17.82 kD |
ext | 15470 |
pI | 4.33 |
Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; |
Database References | NCBI UniProt |
PFAM | PF01248 |
PDB Structures | 2KG4 (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |