Read Date | 2007-10-15 11:38:00 |
---|---|
Read Number | X0000093581224200710151138 |
Week | 1 |
Verified Crystal | |
3-Way Classifier | other |
10-Way Classifier | precip |
Cocktail | 7_C1422 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Ammonium acetate | 5.5 | 0.2 M | O=C(O)C.N |
Bis-Tris | 5.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
PEG 3350 | 5.5 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | HR3159 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 160 aa |
Mass | 17.82 kD |
ext | 15470 |
pI | 4.33 |
Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; |
Database References | NCBI UniProt |
PFAM | PF01248 |
PDB Structures | 2KG4 (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |