| Read Date | 2007-10-16 07:39:00 |
|---|---|
| Read Number | X0000093721483200710160739 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0383 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium phosphate tribasic | 4.0 | 0.1 M | [K+].[K+].[K+].[O-]P([O-]… |
| PEG 20000 | 4.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | NgR43 |
|---|---|
| Spine Status | aggregation screening |
| Length | 289 aa |
| Mass | 31.55 kD |
| ext | 36900 |
| pI | 4.58 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF03848 |
| PDB Structures | 3M70 (Best Match) |
| Gene | |
|---|---|
| Organism | Neisseria gonorrhoeae |
| Genus | Neisseria |
| Species | gonorrhoeae |
| Strain | |
| Sequence | MKERIVGQSGELFCFGQMPVWKVENLPEVLLSGYSSEEGEWVCLNVLQGDVEVRAPDGAAEVWSAESGDCVFAPQQVFSVKPKTDDAEIRLSLYCAAADYFHKKYGMSATHSAVAAAQDTVPAGRALDMGCGQGRNALFLGLKGFDVTAADCNPAALANVAELAEAEGLNVRTLEYDLNAAALQGEFDYIVATVVLMFLMPQRVPDVIADMQAHTAAGGYNLIVSAMDTADFPCPMPFPFKFKEGELKDYYRDWELVEYKEELGAMHAKDENGNPIRFKFVTMLAKKPG |