| Read Date | 2005-06-10 15:19:00 |
|---|---|
| Read Number | X0000050221073200506101519 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 5_C0161 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Sodium chloride | 10.0 | 4.5 M | [Na+].[Cl-] |
![]() | SoR21 |
|---|---|
| Spine Status | good HSQC collected and crystal hits |
| Length | 153 aa |
| Mass | 17.75 kD |
| ext | 32430 |
| pI | 5.44 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF01878 |
| PDB Structures | 2EVE (Best Match) |
| Gene | |
|---|---|
| Organism | Shewanella oneidensis |
| Genus | Shewanella |
| Species | oneidensis |
| Strain | |
| Sequence | MNYWLMKSEPDEFSIEDLKARPNQTEPWFGIRNYQARNYMRDAMQIGDKVFFYHSSCKVPGIVGIAEVVTNAYPDSTAFDPESTYFDPKSDPSNPRWLRVDIRFVEQFKEIIPLSLIKSLPQLADMYLVSKGSRLSIQPVTAEQWQAVLMLSR |