| Read Date | 2007-10-16 08:25:00 |
|---|---|
| Read Number | X0000093761532200710160825 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1535 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
| Tacsimate | 7.0 | 35.0 % (v/v) | missing |
![]() | LaR26 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 215 aa |
| Mass | 23.51 kD |
| ext | 12950 |
| pI | 4.75 |
| Name | Phenylalanyl-tRNA synthetase (Beta subunit) (EC 6.1.1.20) |
| Database References | UniProt |
| PFAM | PF01588 |
| PDB Structures | 3BU2 (Best Match) |
| Gene | |
|---|---|
| Organism | Lactobacillus acidophilus |
| Genus | Lactobacillus |
| Species | acidophilus |
| Strain | |
| Sequence | MITSTNKEAYPNTLIVILGHDEGRSSFEEKEDVTRVTNDKGETIGFNFFNVDKLIDFDKLPNGPVKLSDDELEALNKKLAEVGFDDKLEYGKPTLVYGYVKTCEKHPDSDHLHVTTIEVGDGEEHQIVCGAPNIAQGQKVVVALPGTLMPNGAQIWPGKLRGVDSYGMICSARELGLPHAPQKRGIMVVPDSFEVGAEFEPTKCDELIASGEITL |