| Read Date | 2007-10-19 09:46:00 |
|---|---|
| Read Number | X0000094071364200710190946 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1049 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 7.5 | 0.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 7.5 | 1.2 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SgR69 |
|---|---|
| Spine Status | HSQC collected |
| Length | 129 aa |
| Mass | 14.41 kD |
| ext | 6990 |
| pI | 4.67 |
| Name | Slr1034 protein |
| Database References | NCBI UniProt |
| PFAM | PF00436 |
| PDB Structures | 3KOJ (Best Match) |
| Gene | |
|---|---|
| Organism | Synechocystis sp. |
| Genus | Synechocystis |
| Species | sp. PCC 6803 |
| Strain | |
| Sequence | MNSFVLMATVIREPELRFTKENQTPVCEFLVEFPGMRDDSPKESLKVVGWGNLANTIKETYHPGDRLIIEGRLGMNMIERQEGFKEKRAELTASRISLVDSGNGINPGELSSPPEPEAVDLSNTDDIPF |