| Read Date | 2007-11-02 08:15:00 |
|---|---|
| Read Number | X0000094381380200711020815 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1053 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 1.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.6 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SgR42 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 58 aa |
| Mass | 6.58 kD |
| ext | 8480 |
| pI | 5.13 |
| Name | Ssl0352 protein |
| Database References | NCBI UniProt |
| PFAM | PF11623 |
| PDB Structures | 2JZ2 (NMR) 3C4S (Xray) |
| Gene | |
|---|---|
| Organism | Synechocystis sp. |
| Genus | Synechocystis |
| Species | sp. PCC 6803 |
| Strain | |
| Sequence | MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKPI |