| Read Date | 2007-11-08 10:13:00 |
|---|---|
| Read Number | X0000094431164200711081013 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1035 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 0.5 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SiR152 |
|---|---|
| Spine Status | HSQC collected |
| Length | 157 aa |
| Mass | 17.35 kD |
| ext | 24980 |
| pI | 4.67 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF02367 |
| PDB Structures | 1HTW (Best Match) |
| Gene | |
|---|---|
| Organism | Silicibacter pomeroyi |
| Genus | Ruegeria |
| Species | pomeroyi |
| Strain | |
| Sequence | MTASPLILHLDNPDETAHLAVRLGAALAPGDCLLLSGEIGSGKTHFARHLIQSLLPVAEDIPSPTFTLVQVYDSARGEIWHSDLYRLTGLDEIEELGLSEAFSDAITLVEWPDRLGPLTPDHALHLSFETDPADELKRRLTLSWSDPKWDPRIEALK |