 
    | Read Date | 2007-11-16 09:34:00 | 
|---|---|
| Read Number | X0000094801143200711160934 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | crystal | 
| Cocktail | 8_C0742 | 
| Screen | HWI Generation 8 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium nitrate | 7.0 | 0.1 M | [Na+].[O-][N+]([O-])=O | 
| PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… | 
|  | CdR81 | 
|---|---|
| Spine Status | HSQC collected | 
| Length | 164 aa | 
| Mass | 17.52 kD | 
| ext | 13980 | 
| pI | 4.43 | 
| Name | Hypothetical protein | 
| Database References | NCBI UniProt | 
| PFAM | PF02367 | 
| PDB Structures | 1HTW (Best Match) | 
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae | 
| Genus | Corynebacterium | 
| Species | diphtheriae | 
| Strain | |
| Sequence | MDTTFARSGNIRLETAAETQAFAEELGRHLEAGDVIILDGPLGAGKTTFTQGLARGLNVKGRVTSPTFVIAREHKSLSGGPSLVHVDAYRLIDDAAGATDPIGALDSLDLETELEDAVVVAEWGGGLVEQITDSYLLITFDRTTAHIDDPDSEARIVTWKVIEP |