| Read Date | 2007-11-16 09:34:00 |
|---|---|
| Read Number | X0000094801139200711160934 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 8_C0741 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Sodium molybdate dihydrate | 7.5 | 0.1 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
| PEG 1000 | 7.5 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CdR81 |
|---|---|
| Spine Status | HSQC collected |
| Length | 164 aa |
| Mass | 17.52 kD |
| ext | 13980 |
| pI | 4.43 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF02367 |
| PDB Structures | 1HTW (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium diphtheriae |
| Genus | Corynebacterium |
| Species | diphtheriae |
| Strain | |
| Sequence | MDTTFARSGNIRLETAAETQAFAEELGRHLEAGDVIILDGPLGAGKTTFTQGLARGLNVKGRVTSPTFVIAREHKSLSGGPSLVHVDAYRLIDDAAGATDPIGALDSLDLETELEDAVVVAEWGGGLVEQITDSYLLITFDRTTAHIDDPDSEARIVTWKVIEP |