| Read Date | 2008-01-18 08:45:00 |
|---|---|
| Read Number | X0000096161110200801180845 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1310 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 5.6 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Ammonium sulfate | 5.6 | 2.0 M | O=S(=O)(O)O.N.N |
| Potassium sodium tartrate tetrahydrate | 5.6 | 0.2 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | BhR182 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 156 aa |
| Mass | 17.83 kD |
| ext | 8940 |
| pI | 5.85 |
| Name | BH1408 protein |
| Database References | NCBI UniProt |
| PFAM | PF00583 |
| PDB Structures | 4E0A (Xray) 4F6A (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MIIREATVQDYEEVARLHTQVHEAHVKERGDIFRSNEPTLNPSFFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNDRAKAFYHSLGMRCQKQTMELPL |