X0000100771524200806190921
| Read Date | 2008-06-19 09:21:00 |
|---|---|
| Read Number | X0000100771524200806190921 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1533 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium acetate | 7.0 | 4.0 M | O=C(O)C.N |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
 | StR222A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 106 aa |
| Mass | 12.60 kD |
| ext | 2980 |
| pI | 9.60 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |