| Read Date | 2008-06-19 09:23:00 |
|---|---|
| Read Number | X0000100771351200806190923 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0278 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium nitrate | 6.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
| PEG 20000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | StR222A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 106 aa |
| Mass | 12.60 kD |
| ext | 2980 |
| pI | 9.60 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |