X0000100771364200806190923
| Read Date | 2008-06-19 09:23:00 |
|---|---|
| Read Number | X0000100771364200806190923 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1049 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Trimesic acid | 7.0 | 0.2 % (w/v) | c1c(cc(cc1C(=O)O)C(=O)O)C… |
| Sulfanilic acid | 7.0 | 0.2 % (w/v) | O=S(=O)(O)c1ccc(N)cc1 |
| 4-Aminobutyric acid | 7.0 | 0.2 % (w/v) | C(CC(=O)O)CN |
| 6-Aminohexanoic acid | 7.0 | 0.2 % (w/v) | O=C(O)CCCCCN |
| β-Alanine | 7.0 | 0.2 % (w/v) | O=C(O)CCN |
| Oxamic acid | 7.0 | 0.2 % (w/v) | O=C(N)C(=O)O |
| Tacsimate | 7.0 | 55.0 % (v/v) | missing |
 | StR222A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 106 aa |
| Mass | 12.60 kD |
| ext | 2980 |
| pI | 9.60 |
| Name | Periplasmic protein related to spheroblast formation |
| Database References | UniProt |
| PFAM | PF07813 |
| PDB Structures | 3OEO (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |