Read Date | 2008-06-19 09:30:00 |
---|---|
Read Number | X0000100770953200806190930 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 8A_C0539 |
Screen | HWI Generation 8A |
Name | pH | Concentration | SMILES |
---|---|---|---|
Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
Lithium sulfate monohydrate | 5.0 | 0.1 M | [Li+].[Li+].[O-]S([O-])(=… |
PEG 8000 | 5.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | StR222A |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 106 aa |
Mass | 12.60 kD |
ext | 2980 |
pI | 9.60 |
Name | Periplasmic protein related to spheroblast formation |
Database References | UniProt |
PFAM | PF07813 |
PDB Structures | 3OEO (Best Match) |
Gene | |
---|---|
Organism | Salmonella typhimurium |
Genus | Salmonella |
Species | typhimurium |
Strain | |
Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |