| Read Date | 2008-06-19 09:32:00 | 
|---|---|
| Read Number | X0000100770783200806190932 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0244 | 
| Screen | HWI Generation 8A | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Ammonium nitrate | 6.0 | 0.1 M | [O-][N+]([O-])=O.[NH4+] | 
| PEG 20000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 | 
![]()  | StR222A | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 106 aa | 
| Mass | 12.60 kD | 
| ext | 2980 | 
| pI | 9.60 | 
| Name | Periplasmic protein related to spheroblast formation  | 
| Database References | UniProt | 
| PFAM | PF07813 | 
| PDB Structures | 3OEO (Best Match) | 
| Gene | |
|---|---|
| Organism | Salmonella typhimurium | 
| Genus | Salmonella | 
| Species | typhimurium | 
| Strain | |
| Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |