Read Date | 2008-06-26 15:33:00 |
---|---|
Read Number | X0000100771392200806261533 |
Week | 2 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 8A_C1056 |
Screen | HWI Generation 8A |
Name | pH | Concentration | SMILES |
---|---|---|---|
HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
Gly-gly-gly | 7.0 | 0.2 % (w/v) | O=C(NCC(=O)O)CNC(=O)CN |
Pentaglycine | 7.0 | 0.2 % (w/v) | O=C(NCC(=O)O)CNC(=O)CNC(=… |
Leu-gly-gly | 7.0 | 0.2 % (w/v) | O=C(NCC(=O)O)CNC(=O)C(N)C… |
Aspartame | 7.0 | 0.2 % (w/v) | O=C(O)C[C@H](N)C(=O)N[C@H… |
Tyr-phe | 7.0 | 0.2 % (w/v) | O=C(O)C(NC(=O)C(N)Cc1ccc(… |
Tyr-ala | 7.0 | 0.2 % (w/v) | O=C(O)C(NC(=O)C(N)Cc1ccc(… |
Tacsimate | 7.0 | 55.0 % (v/v) | missing |
![]() | StR222A |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 106 aa |
Mass | 12.60 kD |
ext | 2980 |
pI | 9.60 |
Name | Periplasmic protein related to spheroblast formation |
Database References | UniProt |
PFAM | PF07813 |
PDB Structures | 3OEO (Best Match) |
Gene | |
---|---|
Organism | Salmonella typhimurium |
Genus | Salmonella |
Species | typhimurium |
Strain | |
Sequence | GPHHDMMFKNLNLTDAQKQQIRDIMKAQREQMKRPLLEERRAMHDIIASDTFDKAKAEAQITKMEAQRKANMLAHMETQNKIYNVLTPEQKKQYNANFEKRLTERP |