| Read Date | 2008-09-12 10:30:00 |
|---|---|
| Read Number | X0000103431138200809121030 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1317 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium phosphate monobasic | 6.5 | 0.1 M | [K+].[O-]P(=O)(O)O |
| Sodium chloride | 6.5 | 2.0 M | [Na+].[Cl-] |
| Sodium phosphate monobasic monohydrate | 6.5 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | DhR8C |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 62 aa |
| Mass | 6.79 kD |
| ext | 1490 |
| pI | 5.16 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07873 |
| PDB Structures | 2KS0 (NMR) 2KYI (NMR) 3IPF (Xray) |
| Gene | |
|---|---|
| Organism | Desulfitobacterium hafniense |
| Genus | Desulfitobacterium |
| Species | hafniense |
| Strain | |
| Sequence | DNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYP |