 
    | Read Date | 2009-07-17 10:34:00 | 
|---|---|
| Read Number | X0000111611071200907171034 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0352 | 
| Screen | HWI Generation 9 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O | 
| Potassium thiocyanate | 5.0 | 0.1 M | C(#N)[S-].[K+] | 
| PEG 20000 | 5.0 | 24.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | HR3486E | 
|---|---|
| Spine Status | X-Ray structure | 
| Length | 84 aa | 
| Mass | 10.05 kD | 
| ext | 15470 | 
| pI | 7.10 | 
| Name | RecName: Full=NACHT, LRR and PYD domains-containing protein 1;AltName: Full=Death effector filament-forming ced-4-like apoptosis protein;AltName: Full=Nucleotide-binding domain and caspase recruitment domain;AltName: Full=Caspase recruitment domain-containing protein 7; | 
| Database References | NCBI UniProt | 
| PFAM | PF13516 | 
| PDB Structures | 3KAT (Xray) | 
| Gene | |
|---|---|
| Organism | Homo sapiens | 
| Genus | Homo | 
| Species | sapiens | 
| Strain | |
| Sequence | LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK |