Read Date | 2009-07-17 10:41:00 |
---|---|
Read Number | X0000111610606200907171041 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 9_C0812 |
Screen | HWI Generation 9 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Potassium thiocyanate | 6.0 | 0.1 M | C(#N)[S-].[K+] |
PEG 1000 | 6.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | HR3486E |
---|---|
Spine Status | X-Ray structure |
Length | 84 aa |
Mass | 10.05 kD |
ext | 15470 |
pI | 7.10 |
Name | RecName: Full=NACHT, LRR and PYD domains-containing protein 1;AltName: Full=Death effector filament-forming ced-4-like apoptosis protein;AltName: Full=Nucleotide-binding domain and caspase recruitment domain;AltName: Full=Caspase recruitment domain-containing protein 7; |
Database References | NCBI UniProt |
PFAM | PF13516 |
PDB Structures | 3KAT (Xray) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK |