| Read Date | 2009-07-24 10:16:00 |
|---|---|
| Read Number | X0000111610215200907241016 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0210 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Potassium phosphate dibasic anhydrous | 8.0 | 1.1 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | HR3486E |
|---|---|
| Spine Status | X-Ray structure |
| Length | 84 aa |
| Mass | 10.05 kD |
| ext | 15470 |
| pI | 7.10 |
| Name | RecName: Full=NACHT, LRR and PYD domains-containing protein 1;AltName: Full=Death effector filament-forming ced-4-like apoptosis protein;AltName: Full=Nucleotide-binding domain and caspase recruitment domain;AltName: Full=Caspase recruitment domain-containing protein 7; |
| Database References | NCBI UniProt |
| PFAM | PF13516 |
| PDB Structures | 3KAT (Xray) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKCKDGLYQALKETHPHLIMELWEK |