| Read Date | 2009-08-17 10:59:00 |
|---|---|
| Read Number | X0000112521500200908171059 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C1527 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Potassium sodium tartrate tetrahydrate | 8.5 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | ErR2A |
|---|---|
| Spine Status | HSQC collected |
| Length | 118 aa |
| Mass | 13.11 kD |
| ext | 15930 |
| pI | 4.70 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF00717 |
| PDB Structures | 1UMU (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium leptum |
| Genus | Eubacterium |
| Species | rectale |
| Strain | |
| Sequence | VSAGTGNYLEDSVKETYDVGHLAPEQTDFGVRISGDSMEPLYHTDDVAWIQKKDSLANGEIGIFYLNGNTYIKELHDEPDGVYLISLNQKYRPIQVLESDSFKIFGKVIGKCKGAEIP |