| Read Date | 2009-10-05 12:49:00 |
|---|---|
| Read Number | X0000114121453200910051249 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 9_C0184 |
| Screen | HWI Generation 9 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Sodium phosphate monobasic | 6.0 | 2.2 M | [Na+].[O-]P(=O)(O)O |
![]() | HR3035C |
|---|---|
| Spine Status | HSQC collected |
| Length | 143 aa |
| Mass | 16.70 kD |
| ext | 11460 |
| pI | 5.36 |
| Name | RecName: Full=Sorting nexin-6;AltName: Full=TRAF4-associated factor 2; |
| Database References | NCBI UniProt |
| PFAM | PF00787 |
| PDB Structures | 3HPC (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | ALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDL |