X0000116781447200912171300
| Read Date | 2009-12-17 13:00:00 |
|---|---|
| Read Number | X0000116781447200912171300 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C0374 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Magnesium chloride hexahydrate | 7.5 | 0.2 M | [Mg+2].[Cl-].[Cl-].O.O.O.… |
| Iso-propanol | 7.5 | 27.0 % (v/v) | CC(C)O |
| HEPES-Na | 7.5 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Glycerol anhydrous | 7.5 | 10.0 % (v/v) | C(C(CO)O)O |
 | HR5541B |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 130 aa |
| Mass | 15.08 kD |
| ext | 23950 |
| pI | 5.61 |
| Name | RecName: Full=Signal transducer and activator of transcription 5B; |
| Database References | NCBI UniProt |
| PFAM | PF02864 |
| PDB Structures | 4ZIA (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |