X0000116781388200912171301
| Read Date | 2009-12-17 13:01:00 |
|---|---|
| Read Number | X0000116781388200912171301 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1055 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| Benzidine | 7.0 | 0.1 % (w/v) | c2c(c1ccc(N)cc1)ccc(N)c2 |
| Mellitic acid | 7.0 | 0.1 % (w/v) | O=C(O)c1c(c(c(c(c1C(=O)O)… |
| Cystathionine | 7.0 | 0.1 % (w/v) | O=C(O)C(N)CSCCC(C(=O)O)N |
| L-Carnitine hydrochloride | 7.0 | 0.1 % (w/v) | [Cl-].O=C(O)CC(O)C[N+](C)… |
| L-Cystine | 7.0 | 0.1 % (w/v) | O=C(O)[C@@H](N)CSSC[C@@H]… |
| L-Canavanine | 7.0 | 0.1 % (w/v) | O=C(O)[C@@H](N)CCO\N=C(/N… |
| Barbituric acid | 7.0 | 0.1 % (w/v) | O=C1NC(=O)NC(=O)C1 |
| Tacsimate | 7.0 | 55.0 % (v/v) | missing |
 | HR5541B |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 130 aa |
| Mass | 15.08 kD |
| ext | 23950 |
| pI | 5.61 |
| Name | RecName: Full=Signal transducer and activator of transcription 5B; |
| Database References | NCBI UniProt |
| PFAM | PF02864 |
| PDB Structures | 4ZIA (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |