| Read Date | 2009-12-17 13:05:00 | 
|---|---|
| Read Number | X0000116781142200912171305 | 
| Week | <nil> | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C1318 | 
| Screen | HWI Generation 10 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| PEG 20000 | 6.5 | 12.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 | 
![]()  | HR5541B | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 130 aa | 
| Mass | 15.08 kD | 
| ext | 23950 | 
| pI | 5.61 | 
| Name | RecName: Full=Signal transducer and activator of transcription 5B;  | 
| Database References | NCBI UniProt | 
| PFAM | PF02864 | 
| PDB Structures | 4ZIA (Best Match) | 
| Gene | |
|---|---|
| Organism | Homo sapiens | 
| Genus | Homo | 
| Species | sapiens | 
| Strain | |
| Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |