Read Date | 2009-12-24 11:32:00 |
---|---|
Read Number | X0000116781531200912241132 |
Week | <nil> |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 10_C0767 |
Screen | HWI Generation 10 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Magnesium nitrate hexahydrate | 7.0 | 0.1 M | [Mg+2].[O-][N+]([O-])=O.[… |
PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | HR5541B |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 130 aa |
Mass | 15.08 kD |
ext | 23950 |
pI | 5.61 |
Name | RecName: Full=Signal transducer and activator of transcription 5B; |
Database References | NCBI UniProt |
PFAM | PF02864 |
PDB Structures | 4ZIA (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |