| Read Date | 2010-01-28 11:11:00 |
|---|---|
| Read Number | X0000116781523201001281111 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 10_C0765 |
| Screen | HWI Generation 10 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Magnesium nitrate hexahydrate | 8.0 | 0.1 M | [Mg+2].[O-][N+]([O-])=O.[… |
| PEG 1000 | 8.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | HR5541B |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 130 aa |
| Mass | 15.08 kD |
| ext | 23950 |
| pI | 5.61 |
| Name | RecName: Full=Signal transducer and activator of transcription 5B; |
| Database References | NCBI UniProt |
| PFAM | PF02864 |
| PDB Structures | 4ZIA (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |