| Read Date | 2006-07-07 10:00:00 |
|---|---|
| Read Number | X0000071941519200607071000 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0764 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese sulfate monohydrate | 5.0 | 0.1 M | [Mn+2].[O-]S([O-])(=O)=O.… |
| PEG 1000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | GR85 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 62 aa |
| Mass | 7.43 kD |
| ext | 2980 |
| pI | 8.93 |
| Name | Hypothetical UPF0165 protein AF1095 |
| Database References | NCBI UniProt |
| PFAM | PF01954 |
| PDB Structures | 2NWT (Best Match) |
| Gene | |
|---|---|
| Organism | Archaeoglobus fulgidus |
| Genus | Archaeoglobus |
| Species | fulgidus |
| Strain | |
| Sequence | MPKIIEAIYENGVFKPLQKVDLKEGERIKLRIEEGILDVIKKYQGKFKLTEKDIEKFLEERR |