| Read Date | 2006-08-25 08:06:00 |
|---|---|
| Read Number | X0000074231348200608250806 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1045 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.4 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SfR140 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 128 aa |
| Mass | 14.37 kD |
| ext | 20970 |
| pI | 4.35 |
| Name | Putative tail component of prophage CP-933K |
| Database References | NCBI UniProt |
| PFAM | PF06894 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |