Read Date | 2006-08-25 08:14:00 |
---|---|
Read Number | X0000074230852200608250814 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 6_C1401 |
Screen | HWI Generation 6 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Ammonium sulfate | 6.5 | 0.1 M | O=S(=O)(O)O.N.N |
Bis-Tris | 6.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
Pentaerythritol ethoxylate (15/4 EO/OH) | 6.5 | 30.0 % (v/v) | C(C(CO)(CO)CO)O |
![]() | SfR140 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 128 aa |
Mass | 14.37 kD |
ext | 20970 |
pI | 4.35 |
Name | Putative tail component of prophage CP-933K |
Database References | NCBI UniProt |
PFAM | PF06894 |
PDB Structures |
Gene | |
---|---|
Organism | Shigella flexneri |
Genus | Shigella |
Species | flexneri |
Strain | |
Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |