Read Date | 2006-08-25 08:18:00 |
---|---|
Read Number | X0000074230595200608250818 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 6_C0233 |
Screen | HWI Generation 6 |
Name | pH | Concentration | SMILES |
---|---|---|---|
MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
Ammonium thiocyanate | 7.0 | 2.7 M | [S-]C#N.[NH4+] |
![]() | SfR140 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 128 aa |
Mass | 14.37 kD |
ext | 20970 |
pI | 4.35 |
Name | Putative tail component of prophage CP-933K |
Database References | NCBI UniProt |
PFAM | PF06894 |
PDB Structures |
Gene | |
---|---|
Organism | Shigella flexneri |
Genus | Shigella |
Species | flexneri |
Strain | |
Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |