Read Date | 2006-08-25 11:15:00 |
---|---|
Read Number | X0000074230530200608251115 |
Week | 1 |
Verified Crystal | |
3-Way Classifier | |
10-Way Classifier | |
Cocktail | 6_C1273 |
Screen | HWI Generation 6 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Sodium acetate trihydrate | 6.5 | 1.0 M | [Na+].[O-]C(=O)C.O.O.O |
Imidazole | 6.5 | 0.1 M | c1cnc[nH]1 |
![]() | SfR140 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 128 aa |
Mass | 14.37 kD |
ext | 20970 |
pI | 4.35 |
Name | Putative tail component of prophage CP-933K |
Database References | NCBI UniProt |
PFAM | PF06894 |
PDB Structures |
Gene | |
---|---|
Organism | Shigella flexneri |
Genus | Shigella |
Species | flexneri |
Strain | |
Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |