| Read Date | 2006-09-08 16:20:00 |
|---|---|
| Read Number | X0000074230774200609081620 |
| Week | 3 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0818 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium chloride | 8.0 | 0.1 M | [Na+].[Cl-] |
| PEG 1000 | 8.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SfR140 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 128 aa |
| Mass | 14.37 kD |
| ext | 20970 |
| pI | 4.35 |
| Name | Putative tail component of prophage CP-933K |
| Database References | NCBI UniProt |
| PFAM | PF06894 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |