| Read Date | 2005-08-12 07:47:00 |
|---|---|
| Read Number | X0000055511218200508120747 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C1229 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium chloride | 8.0 | 1.0 M | [Na+].[Cl-] |
![]() | PfR75 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 103 aa |
| Mass | 12.37 kD |
| ext | 17420 |
| pI | 4.75 |
| Name | Hypothetical protein PF0246 |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2K4N (NMR) |
| Gene | |
|---|---|
| Organism | Pyrococcus furiosus |
| Genus | Pyrococcus |
| Species | furiosus |
| Strain | |
| Sequence | MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTK |